MUC20 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15968
Article Name: MUC20 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15968
Supplier Catalog Number: A15968
Alternative Catalog Number: ABB-A15968-100UL,ABB-A15968-20UL,ABB-A15968-1000UL,ABB-A15968-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MUC-20, MUC20
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins secreted by many epithelial tissues to form an insoluble mucous barrier. The C-terminus of this family member associates with the multifunctional docking site of the MET proto-oncogene and suppresses activation of some downstream MET signaling cascades. The protein features a mucin tandem repeat domain that varies between two and six copies in most individuals. Multiple variants encoding different isoforms have been found for this gene. A related pseudogene, which is also located on chromosome 3, has been identified.
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 200958
UniProt: Q8N307
Purity: Affinity purification
Sequence: PNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD
Target: MUC20
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag
Western blot analysis of various lysates using MUC20 Rabbit pAb (A15968) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.