EBF3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15973
Article Name: EBF3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15973
Supplier Catalog Number: A15973
Alternative Catalog Number: ABB-A15973-20UL,ABB-A15973-100UL,ABB-A15973-500UL,ABB-A15973-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: COE3, OE-2, EBF-3, HADDS, O/E-2, EBF3
This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma.
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 253738
UniProt: Q9H4W6
Purity: Affinity purification
Sequence: AEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGF
Target: EBF3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Rat thymus, using EBF3 Rabbit pAb (A15973) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.