HNRNPCL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16011
Article Name: HNRNPCL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16011
Supplier Catalog Number: A16011
Alternative Catalog Number: ABB-A16011-100UL,ABB-A16011-20UL,ABB-A16011-1000UL,ABB-A16011-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HNRPCL1, HNRNPCL1
Enables identical protein binding activity. Predicted to be active in nucleus.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 343069
UniProt: O60812
Purity: Affinity purification
Sequence: NLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMESEGGAEDSAEEGDPLDDDVNEDQGDDQLELIKDDEKEAEEGEDDRDSTNGQDDS
Target: HNRNPCL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using HNRNPCL1 Rabbit pAb (A16011) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.