SNRPD3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16070
Article Name: SNRPD3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16070
Supplier Catalog Number: A16070
Alternative Catalog Number: ABB-A16070-100UL,ABB-A16070-20UL,ABB-A16070-500UL,ABB-A16070-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SMD3, Sm-D3, SNRPD3
This gene encodes a core component of the spliceosome, which is a nuclear ribonucleoprotein complex that functions in pre-mRNA splicing. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 6634
UniProt: P62318
Purity: Affinity purification
Sequence: KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
Target: SNRPD3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using SNRPD3 Rabbit pAb (A16070) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.