ALDH5A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16074
Article Name: ALDH5A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16074
Supplier Catalog Number: A16074
Alternative Catalog Number: ABB-A16074-100UL,ABB-A16074-20UL,ABB-A16074-500UL,ABB-A16074-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SSDH, SSADH, ALDH5A1
This protein belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 7915
UniProt: P51649
Purity: Affinity purification
Sequence: VSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSV
Target: ALDH5A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism,Lipid Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using ALDH5A1 Rabbit pAb (A16074) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.