CREG1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16081
Article Name: CREG1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16081
Supplier Catalog Number: A16081
Alternative Catalog Number: ABB-A16081-100UL,ABB-A16081-20UL,ABB-A16081-1000UL,ABB-A16081-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CREG, CREG1
The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation.
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 8804
UniProt: O75629
Purity: Affinity purification
Sequence: LQLSVSNLQENPYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFA
Target: CREG1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag
Western blot analysis of lysates from K-562 cells, using CREG1 Rabbit pAb (A16081) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.