PROZ Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16082
Article Name: PROZ Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16082
Supplier Catalog Number: A16082
Alternative Catalog Number: ABB-A16082-100UL,ABB-A16082-20UL,ABB-A16082-1000UL,ABB-A16082-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PZ, PROZ
This gene encodes a liver vitamin K-dependent glycoprotein that is synthesized in the liver and secreted into the plasma. The encoded protein plays a role in regulating blood coagulation by complexing with protein Z-dependent protease inhibitor to directly inhibit activated factor X at the phospholipid surface. Deficiencies in this protein are associated with an increased risk of ischemic arterial diseases and fetal loss. Mutations in this gene are the cause of protein Z deficiency. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 8858
UniProt: P22891
Purity: Affinity purification
Sequence: SLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTY
Target: PROZ
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag
Western blot analysis of various lysates using PROZ Rabbit pAb (A16082) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.