BPIFB2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16148
- Images (1)
| Article Name: | BPIFB2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16148 |
| Supplier Catalog Number: | A16148 |
| Alternative Catalog Number: | ABB-A16148-20UL,ABB-A16148-100UL,ABB-A16148-500UL,ABB-A16148-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RYSR, BPIL1, LPLUNC2, C20orf184, dJ726C3.2, BPIFB2 |
| This gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromosome 20. |
| Clonality: | Polyclonal |
| Molecular Weight: | 49kDa |
| NCBI: | 80341 |
| UniProt: | Q8N4F0 |
| Purity: | Affinity purification |
| Sequence: | IGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNT |
| Target: | BPIFB2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using BPIFB2 Rabbit pAb (A16148) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Product Guarantee and Expert Support
