MAS1L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16161
Article Name: MAS1L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16161
Supplier Catalog Number: A16161
Alternative Catalog Number: ABB-A16161-20UL,ABB-A16161-100UL,ABB-A16161-1000UL,ABB-A16161-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MRG, MAS-L, dJ994E9.2, MAS1L
Predicted to enable G protein-coupled receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in cytosol, nucleoplasm, and plasma membrane.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 116511
UniProt: P35410
Purity: Affinity purification
Sequence: MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ
Target: MAS1L
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using MAS1L Rabbit pAb (A16161) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.