SLC34A3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16168
Article Name: SLC34A3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16168
Supplier Catalog Number: A16168
Alternative Catalog Number: ABB-A16168-20UL,ABB-A16168-100UL,ABB-A16168-500UL,ABB-A16168-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HHRH, NPT2C, NPTIIc, SLC34A3
This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5 UTR have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 142680
UniProt: Q8N130
Purity: Affinity purification
Sequence: MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSN
Target: SLC34A3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC34A3 Rabbit pAb (A16168) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.