GPR155 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16173
Article Name: GPR155 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16173
Supplier Catalog Number: A16173
Alternative Catalog Number: ABB-A16173-20UL,ABB-A16173-100UL,ABB-A16173-500UL,ABB-A16173-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DEP.7, PGR22, DEPDC3, GPR155
Involved in cognition. Located in extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 151556
UniProt: Q7Z3F1
Purity: Affinity purification
Sequence: PFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQSPPAINANTLQQERYKEIEHSSPPSHSPKT
Target: GPR155
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of various lysates using GPR155 Rabbit pAb (A16173) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.