SERPINA9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16182
Article Name: SERPINA9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16182
Supplier Catalog Number: A16182
Alternative Catalog Number: ABB-A16182-20UL,ABB-A16182-100UL,ABB-A16182-1000UL,ABB-A16182-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GCET1, SERPINA11, SERPINA11b, SERPINA9
Enables serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to be located in cytoplasm and membrane. Predicted to be active in extracellular space.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 327657
UniProt: Q86WD7
Purity: Affinity purification
Sequence: TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ
Target: SERPINA9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Ubiquitin,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of lysates from Human serum, using SERPINA9 Rabbit pAb (A16182) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.