PKC mu Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16185
Article Name: PKC mu Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16185
Supplier Catalog Number: A16185
Alternative Catalog Number: ABB-A16185-100UL,ABB-A16185-20UL,ABB-A16185-500UL,ABB-A16185-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PKD, PKCM, CHDED, PRKCM, PKC-MU, PKC mu
The protein encoded by this gene is a serine/threonine protein kinase involved in many cellular processes, including Golgi body membrane integrity and transport, cell migration and differentiation, MAPK8/JNK1 and Ras pathway signaling, MAPK1/3 (ERK1/2) pathway signaling, cell survival, and regulation of cell shape and adhesion.
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 5587
UniProt: Q15139
Purity: Affinity purification
Sequence: YPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
Target: PRKD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Autophagy,Cytoskeleton,Actins,Endocrine Metabolism,Lipid Metabolism,Immunology Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using PKC mu Rabbit pAb (A16185) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.