MAGOHB Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16192
- Images (1)
| Article Name: | MAGOHB Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16192 |
| Supplier Catalog Number: | A16192 |
| Alternative Catalog Number: | ABB-A16192-20UL,ABB-A16192-100UL,ABB-A16192-1000UL,ABB-A16192-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MGN2, mago, magoh, MAGOHB |
| Enables RNA binding activity. Involved in mRNA splicing, via spliceosome and nuclear-transcribed mRNA catabolic process, nonsense-mediated decay. Located in nucleus. Part of U2-type catalytic step 1 spliceosome, U2-type precatalytic spliceosome, and exon-exon junction complex. |
| Clonality: | Polyclonal |
| Molecular Weight: | 17kDa |
| NCBI: | 55110 |
| UniProt: | Q96A72 |
| Purity: | Affinity purification |
| Sequence: | MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
| Target: | MAGOHB |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MAGOHB Rabbit pAb (A16192) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
