MRPL18 Rabbit pAb, Polyclonal

Catalog Number: ABB-A16231
Article Name: MRPL18 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16231
Supplier Catalog Number: A16231
Alternative Catalog Number: ABB-A16231-100UL,ABB-A16231-20UL,ABB-A16231-500UL,ABB-A16231-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: L18mt, HSPC071, MRP-L18, MRPL18
This nuclear gene encodes a protein component of the larger 39S subunit of mitochondrial ribosome. This protein may also aid in the import of nuclear-encoded 5S rRNA into mitochondria. Alternative splicing results in multiple transcript variants, most of which are not predicted to encode a protein. A pseudogene of this gene is found on chromosome 16.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 29074
UniProt: Q9H0U6
Purity: Affinity purification
Sequence: MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA
Target: MRPL18
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of various lysates using MRPL18 Rabbit pAb (A16231) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.