USP9X Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16307
Article Name: USP9X Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16307
Supplier Catalog Number: A16307
Alternative Catalog Number: ABB-A16307-100UL,ABB-A16307-20UL,ABB-A16307-1000UL,ABB-A16307-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FAF, FAM, hFAM, DFFRX, MRX99, XLID99, MRXS99F, USP9X
This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Clonality: Polyclonal
Molecular Weight: 290kDa
NCBI: 8239
UniProt: Q93008
Purity: Affinity purification
Sequence: MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEA
Target: USP9X
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using USP9X Rabbit pAb (A16307) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.