FSP1/S100A4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1631
Article Name: FSP1/S100A4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1631
Supplier Catalog Number: A1631
Alternative Catalog Number: ABB-A1631-100UL,ABB-A1631-20UL,ABB-A1631-1000UL,ABB-A1631-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: 42A, 18A2, CAPL, FSP1, MTS1, P9KA, PEL98, FSP1/S100A4
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Clonality: Polyclonal
Molecular Weight: 12 kDa
NCBI: 6275
UniProt: P26447
Purity: Affinity purification
Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Target: S100A4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:5000|IF/ICC,1:100 - 1:400|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Extracellular Matrix,Neuroscience,Calcium Signaling,Cardiovascular,Angiogenesis,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using FSP1/S100A4 Rabbit pAb (A1631) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.