Apoe Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16344
Article Name: Apoe Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16344
Supplier Catalog Number: A16344
Alternative Catalog Number: ABB-A16344-100UL,ABB-A16344-20UL,ABB-A16344-1000UL,ABB-A16344-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Apo-E, Apoe
This gene encodes a member of the apolipoprotein A1/A4/E family of proteins. This protein is involved in the transport of lipoproteins in the blood. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Homozygous knockout mice for this gene accumulate high levels of cholesterol in the blood and develop atherosclerosis. Different alleles of this gene have been associated with either increased risk or a protective effect for Alzheimers disease in human patients. This gene maps to chromosome 7 in a cluster with the related apolipoprotein C1, C2 and C4 genes.
Clonality: Polyclonal
Molecular Weight: 36 kDa
NCBI: 11816
UniProt: P02649
Purity: Affinity purification
Sequence: QPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Target: Apoe
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology & Developmental Biology,Endocrine & Metabolism,Lipid Metabolism,Cholesterol Metabolism,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Stem Cells,Cardiovascular,Lipids,Lipoproteins/Apolipoproteins. Shipping: Ice Bag
Western blot analysis of various lysates using Apoe Rabbit pAb (A16344) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.