OCM2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16410
Article Name: OCM2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16410
Supplier Catalog Number: A16410
Alternative Catalog Number: ABB-A16410-20UL,ABB-A16410-100UL,ABB-A16410-1000UL,ABB-A16410-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OM, OCM, OCM2
This gene is similar to the oncomodulin gene, a high-affinity calcium ion-binding protein that belongs to the superfamily of calmodulin proteins, also known as the EF-hand proteins.
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 4951
UniProt: P0CE71
Purity: Affinity purification
Sequence: MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
Target: OCM2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. Shipping: Ice Bag
Western blot analysis of lysates from rat kidney, using OCM2 Rabbit pAb (A16410) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.