DNA topoisomerase II alpha (TOP2A) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16440
Article Name: DNA topoisomerase II alpha (TOP2A) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16440
Supplier Catalog Number: A16440
Alternative Catalog Number: ABB-A16440-20UL,ABB-A16440-100UL,ABB-A16440-1000UL,ABB-A16440-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TOP2, TP2A, TOPIIA, TOP2alpha, DNA topoisomerase II alpha (TOP2A)
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.
Clonality: Polyclonal
Molecular Weight: 174kDa
NCBI: 7153
UniProt: P11388
Purity: Affinity purification
Sequence: EEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
Target: TOP2A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Centrosome,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag
Western blot analysis of various lysates using DNA topoisomerase II alpha (TOP2A) Rabbit pAb (A16440) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.