SHP/NR0B2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16454
Article Name: SHP/NR0B2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16454
Supplier Catalog Number: A16454
Alternative Catalog Number: ABB-A16454-1000UL,ABB-A16454-20UL,ABB-A16454-500UL,ABB-A16454-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SHP, SHP1, SHP/NR0B2
The protein encoded by this gene is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. The gene product is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 8431
UniProt: Q15466
Purity: Affinity purification
Sequence: LCRQHRPVQLCAPHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKKILLE
Target: NR0B2
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SHP/NR0B2 Rabbit pAb (A16454) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.