SRSF1/SF2/ASF Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1649
- Images (1)
| Article Name: | SRSF1/SF2/ASF Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1649 |
| Supplier Catalog Number: | A1649 |
| Alternative Catalog Number: | ABB-A1649-100UL,ABB-A1649-20UL,ABB-A1649-500UL,ABB-A1649-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ASF, SF2, SFRS1, SF2p33, SRp30a, SRSF1/SF2/ASF |
| This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. |
| Clonality: | Polyclonal |
| Molecular Weight: | 28kDa |
| NCBI: | 6426 |
| UniProt: | Q07955 |
| Purity: | Affinity purification |
| Sequence: | MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT |
| Target: | SRSF1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SRSF1/SF2/ASF Rabbit pAb (A1649) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
