P2RY10 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16517
- Images (1)
| Article Name: | P2RY10 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16517 |
| Supplier Catalog Number: | A16517 |
| Alternative Catalog Number: | ABB-A16517-20UL,ABB-A16517-100UL,ABB-A16517-500UL,ABB-A16517-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | LPS2, P2Y10, LYPSR2, P2RY10 |
| The protein encoded by this gene belongs to the family of G-protein coupled receptors that are preferentially activated by adenosine and uridine nucleotides. There is a pseudogene for this gene nearby on chromosome X. Multiple alternatively spliced transcripts have been observed. |
| Clonality: | Polyclonal |
| Molecular Weight: | 39kDa |
| NCBI: | 27334 |
| UniProt: | O00398 |
| Purity: | Affinity purification |
| Sequence: | TVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG |
| Target: | P2RY10 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using P2RY10 Rabbit pAb (A16517) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
Product Guarantee and Expert Support
