ELOVL5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16567
Article Name: ELOVL5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16567
Supplier Catalog Number: A16567
Alternative Catalog Number: ABB-A16567-20UL,ABB-A16567-100UL,ABB-A16567-500UL,ABB-A16567-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HELO1, SCA38, dJ483K16.1, ELOVL5
This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38). Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 60481
UniProt: Q9NYP7
Purity: Affinity purification
Sequence: GVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Target: ELOVL5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using ELOVL5 Rabbit pAb (A16567) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.