Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1658
Article Name: Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1658
Supplier Catalog Number: A1658
Alternative Catalog Number: ABB-A1658-20UL,ABB-A1658-100UL,ABB-A1658-500UL,ABB-A1658-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MN, CAIX, Carbonic Anhydrase 9 (CA9/G250)
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 768
UniProt: Q16790
Purity: Affinity purification
Sequence: GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR
Target: CA9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Cardiovascular,Hypoxia. Shipping: Ice Bag
Western blot analysis of various lysates using Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A1658) at 1:100 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.