ARHGAP11B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16587
Article Name: ARHGAP11B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16587
Supplier Catalog Number: A16587
Alternative Catalog Number: ABB-A16587-100UL,ABB-A16587-20UL,ABB-A16587-1000UL,ABB-A16587-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: B-T, FAM7B1, GAP (1-8), ARHGAP11B
Predicted to enable GTPase activator activity. Involved in cerebral cortex development and negative regulation of mitochondrial membrane permeability. Acts upstream of with a positive effect on glutamine catabolic process. Located in mitochondrial matrix.
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 89839
UniProt: Q3KRB8
Purity: Affinity purification
Sequence: EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV
Target: ARHGAP11B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using ARHGAP11B Rabbit pAb (A16587) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 2s.