CDCA5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16590
Article Name: CDCA5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16590
Supplier Catalog Number: A16590
Alternative Catalog Number: ABB-A16590-100UL,ABB-A16590-20UL,ABB-A16590-500UL,ABB-A16590-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SORORIN, CDCA5
Predicted to enable chromatin binding activity. Involved in double-strand break repair, mitotic sister chromatid segregation, and regulation of cell cycle process. Located in nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 113130
UniProt: Q96FF9
Purity: Affinity purification
Sequence: VPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLE
Target: CDCA5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using CDCA5 Rabbit pAb (A16590) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.