NOMO2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16614
- Images (1)
| Article Name: | NOMO2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16614 |
| Supplier Catalog Number: | A16614 |
| Alternative Catalog Number: | ABB-A16614-100UL,ABB-A16614-20UL,ABB-A16614-1000UL,ABB-A16614-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PM5, Nomo, NOMO2 |
| This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). Two transcripts encoding different isoforms have been described. |
| Clonality: | Polyclonal |
| Molecular Weight: | 139kDa |
| NCBI: | 283820 |
| UniProt: | Q5JPE7 |
| Purity: | Affinity purification |
| Sequence: | YALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYIL |
| Target: | NOMO2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from BxPC3 cells, using NOMO2 Rabbit pAb (A16614) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
