NPSR1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16618
Article Name: NPSR1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16618
Supplier Catalog Number: A16618
Alternative Catalog Number: ABB-A16618-100UL,ABB-A16618-20UL,ABB-A16618-500UL,ABB-A16618-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GPRA, NPSR, VRR1, ASRT2, PGR14, GPR154, NPSR1
This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 387129
UniProt: Q6W5P4
Purity: Affinity purification
Sequence: SKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI
Target: NPSR1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using NPSR1 Rabbit pAb (A16618) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.