NFAT5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16649
Article Name: NFAT5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16649
Supplier Catalog Number: A16649
Alternative Catalog Number: ABB-A16649-100UL,ABB-A16649-20UL,ABB-A16649-1000UL,ABB-A16649-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NFATZ, OREBP, NF-AT5, NFATL1, TONEBP, NFAT5
The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 166kDa
NCBI: 10725
UniProt: O94916
Purity: Affinity purification
Sequence: NQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Target: NFAT5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Immunology Inflammation,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using NFAT5 Rabbit pAb (A16649) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.