CHGA Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1668
- Images (1)
| Article Name: | CHGA Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1668 |
| Supplier Catalog Number: | A1668 |
| Alternative Catalog Number: | ABB-A1668-20UL,ABB-A1668-100UL,ABB-A1668-1000UL,ABB-A1668-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CGA, PHE5, PHES, CHGA |
| The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides, vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 51kDa |
| NCBI: | 1113 |
| UniProt: | P10645 |
| Purity: | Affinity purification |
| Sequence: | EEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARA |
| Target: | CHGA |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CHGA Rabbit pAb (A1668) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
