FCN2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A16690
Article Name: FCN2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16690
Supplier Catalog Number: A16690
Alternative Catalog Number: ABB-A16690-20UL,ABB-A16690-100UL,ABB-A16690-1000UL,ABB-A16690-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: P35, FCNL, EBP-37, ficolin-2, FCN2
The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified.
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 2220
UniProt: Q15485
Purity: Affinity purification
Sequence: SAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANG
Target: FCN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag
Western blot analysis of various lysates using FCN2 Rabbit pAb (A16690) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.