CDC25C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1672
Article Name: CDC25C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1672
Supplier Catalog Number: A1672
Alternative Catalog Number: ABB-A1672-100UL,ABB-A1672-20UL,ABB-A1672-500UL,ABB-A1672-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CDC25, PPP1R60, CDC25C
This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described.
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 995
UniProt: P30307
Purity: Affinity purification
Sequence: SFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
Target: CDC25C
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,MAPK-Erk Signaling Pathway,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag
Western blot analysis of various lysates using CDC25C Rabbit pAb (A1672) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.