KPNA3 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A16907
- Images (1)
| Article Name: | KPNA3 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A16907 |
| Supplier Catalog Number: | A16907 |
| Alternative Catalog Number: | ABB-A16907-100UL,ABB-A16907-20UL,ABB-A16907-1000UL,ABB-A16907-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | SRP1, SRP4, IPOA4, SPG88, hSRP1, SRP1gamma, KPNA3 |
| The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. |
| Clonality: | Polyclonal |
| Molecular Weight: | 58kDa |
| NCBI: | 3839 |
| UniProt: | O00505 |
| Purity: | Affinity purification |
| Sequence: | MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP |
| Target: | KPNA3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells using KPNA3 Rabbit pAb (A16907) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Product Guarantee and Expert Support
