MAD2/MAD2L1 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A16911
- Images (1)
| Article Name: | MAD2/MAD2L1 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A16911 |
| Supplier Catalog Number: | A16911 |
| Alternative Catalog Number: | ABB-A16911-20UL,ABB-A16911-100UL,ABB-A16911-500UL,ABB-A16911-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | MAD2, HSMAD2, MAD2/MAD2L1 |
| MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. |
| Clonality: | Polyclonal |
| Molecular Weight: | 24kDa |
| NCBI: | 4085 |
| UniProt: | Q13257 |
| Purity: | Affinity purification |
| Sequence: | MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND |
| Target: | MAD2L1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MAD2/MAD2/MAD2L1 Rabbit pAb (A16911) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
