MUC4 Rabbit pAb, Polyclonal

Catalog Number: ABB-A16922
Article Name: MUC4 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16922
Supplier Catalog Number: A16922
Alternative Catalog Number: ABB-A16922-100UL,ABB-A16922-20UL,ABB-A16922-1000UL,ABB-A16922-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: ASGP, MUC-4, HSA276359, MUC4
The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats.
Clonality: Polyclonal
Molecular Weight: 542kDa
NCBI: 4585
UniProt: Q99102
Purity: Affinity purification
Sequence: RCSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGALGGLLLLGVGTFVVLRFWGCSGARFSYFLNSAEALP
Target: MUC4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using MUC4 Rabbit pAb (A16922) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.