PCYT1A Rabbit pAb, Polyclonal

Catalog Number: ABB-A16943
Article Name: PCYT1A Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16943
Supplier Catalog Number: A16943
Alternative Catalog Number: ABB-A16943-20UL,ABB-A16943-100UL,ABB-A16943-1000UL,ABB-A16943-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: CT, CTA, CCTA, CTPCT, PCYT1, SMDCRD, CCTalpha, PCYT1A
This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 5130
UniProt: P49585
Purity: Affinity purification
Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAK
Target: PCYT1A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using PCYT1A Rabbit pAb (A16943) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.