PEX10 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A16949
- Images (1)
| Article Name: | PEX10 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A16949 |
| Supplier Catalog Number: | A16949 |
| Alternative Catalog Number: | ABB-A16949-20UL,ABB-A16949-100UL,ABB-A16949-500UL,ABB-A16949-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | NALD, PBD6A, PBD6B, RNF69, PEX10 |
| This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 37kDa |
| NCBI: | 5192 |
| UniProt: | O60683 |
| Purity: | Affinity purification |
| Sequence: | EVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRAL |
| Target: | PEX10 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from U-87MG cells, using PEX10 Rabbit pAb (A16949) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
