ADRA2C Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16956
- Images (1)
| Article Name: | ADRA2C Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16956 |
| Supplier Catalog Number: | A16956 |
| Alternative Catalog Number: | ABB-A16956-100UL,ABB-A16956-20UL,ABB-A16956-1000UL,ABB-A16956-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ADRA2L2, ADRARL2, ADRA2RL2, ALPHA2CAR, ADRA2C |
| Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. The mouse studies revealed that both the alpha2A and alpha2C subtypes were required for normal presynaptic control of transmitter release from sympathetic nerves in the heart and from central noradrenergic neurons. The alpha2A subtype inhibited transmitter release at high stimulation frequencies, whereas the alpha2C subtype modulated neurotransmission at lower levels of nerve activity. This gene encodes the alpha2C subtype, which contains no introns in either its coding or untranslated sequences. |
| Clonality: | Polyclonal |
| Molecular Weight: | 50kDa |
| NCBI: | 152 |
| UniProt: | P18825 |
| Purity: | Affinity purification |
| Sequence: | RTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRF |
| Target: | ADRA2C |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ADRA2C Rabbit pAb (A16956) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
