ZNF711 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17008
Article Name: ZNF711 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17008
Supplier Catalog Number: A17008
Alternative Catalog Number: ABB-A17008-20UL,ABB-A17008-100UL,ABB-A17008-1000UL,ABB-A17008-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: ZNF4, ZNF5, ZNF6, CMPX1, MRX65, MRX97, XLID97, Zfp711, dJ75N13.1, ZNF711
This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptional activator. This gene lies in a region of the X chromosome which has been associated with cognitive disability.
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 7552
UniProt: Q9Y462
Purity: Affinity purification
Sequence: SEDYLMISLDDVGEKLEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVLDQSRMQREKMVYMAVKDSSQ
Target: ZNF711
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using ZNF711 Rabbit pAb (A17008) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.