SLC25A16 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17016
Article Name: SLC25A16 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17016
Supplier Catalog Number: A17016
Alternative Catalog Number: ABB-A17016-20UL,ABB-A17016-100UL,ABB-A17016-500UL,ABB-A17016-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: GDA, GDC, ML7, hML7, HGT.1, D10S105E, SLC25A16
This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves disease.
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 8034
UniProt: P16260
Purity: Affinity purification
Sequence: APYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL
Target: SLC25A16
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using SLC25A16 Rabbit pAb (A17016) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.