AXIN2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17021
Article Name: AXIN2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17021
Supplier Catalog Number: A17021
Alternative Catalog Number: ABB-A17021-20UL,ABB-A17021-100UL,ABB-A17021-500UL,ABB-A17021-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: AXIL, ODCRCS, AXIN2
The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex of APC (adenomatous polyposis of the colon), beta-catenin, glycogen synthase kinase 3-beta, and conductin, which leads to the degradation of beta-catenin. Apparently, the deregulation of beta-catenin is an important event in the genesis of a number of malignancies. The AXIN2 gene has been mapped to 17q23-q24, a region that shows frequent loss of heterozygosity in breast cancer, neuroblastoma, and other tumors. Mutations in this gene have been associated with colorectal cancer with defective mismatch repair.
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 8313
UniProt: Q9Y2T1
Purity: Affinity purification
Sequence: EDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLL
Target: AXIN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell differentiation,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Neuroscience,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using AXIN2 Rabbit pAb (A17021) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.