CFL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1704
Article Name: CFL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1704
Supplier Catalog Number: A1704
Alternative Catalog Number: ABB-A1704-20UL,ABB-A1704-100UL,ABB-A1704-500UL,ABB-A1704-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CFL, cofilin, HEL-S-15, CFL1
The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 1072
UniProt: P23528
Purity: Affinity purification
Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLV
Target: CFL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Adhesion,Cytoskeleton,Microfilaments,Microtubules,Actins,TGF-b-Smad Signaling Pathway,Immunology Inflammation,Neuroscience, Cell Type Marker,Cardiovascular,Heart,Contractility,Neuron marker. Shipping: Ice Bag
Western blot analysis of various lysates using CFL1 Rabbit pAb (A1704) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.