PIGQ Rabbit pAb, Polyclonal
Catalog Number:
ABB-A17044
- Images (1)
| Article Name: | PIGQ Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A17044 |
| Supplier Catalog Number: | A17044 |
| Alternative Catalog Number: | ABB-A17044-100UL,ABB-A17044-20UL,ABB-A17044-500UL,ABB-A17044-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | GPI1, DEE77, EIEE77, MCAHS4, GPIBD19, c407A10.1, PIGQ |
| This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 84kDa |
| NCBI: | 9091 |
| UniProt: | Q9BRB3 |
| Purity: | Affinity purification |
| Sequence: | MVLKAFFPTCCVSTDSGLLVGRWVPEQSSAVVLAVLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESLGAVFPHEPWLRLCRERGGTFWSCEATHRQAPTAPGAPGEDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQSEGVEASI |
| Target: | PIGQ |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PIGQ Rabbit pAb (A17044) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
