RAB33A Rabbit pAb, Polyclonal

Catalog Number: ABB-A17049
Article Name: RAB33A Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17049
Supplier Catalog Number: A17049
Alternative Catalog Number: ABB-A17049-100UL,ABB-A17049-20UL,ABB-A17049-1000UL,ABB-A17049-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: RabS10, RAB33A
The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport.
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 9363
UniProt: Q14088
Purity: Affinity purification
Sequence: DVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Target: RAB33A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RAB33A Rabbit pAb (A17049) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.