betaIII-Tubulin Rabbit pAb, Polyclonal
Catalog Number:
ABB-A17073
- Images (1)
| Article Name: | betaIII-Tubulin Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A17073 |
| Supplier Catalog Number: | A17073 |
| Alternative Catalog Number: | ABB-A17073-100UL,ABB-A17073-20UL,ABB-A17073-500UL,ABB-A17073-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | CDCBM, FEOM3, TUBB4, CDCBM1, CFEOM3, beta-4, CFEOM3A, betaIII-Tubulin |
| This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. |
| Clonality: | Polyclonal |
| Molecular Weight: | 50kDa |
| NCBI: | 10381 |
| UniProt: | Q13509 |
| Purity: | Affinity purification |
| Sequence: | SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF |
| Target: | TUBB3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using betaIII-Tubulin Rabbit pAb (A17073) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
