TMEM147 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A17076
| Article Name: |
TMEM147 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: |
ABB-A17076 |
| Supplier Catalog Number: |
A17076 |
| Alternative Catalog Number: |
ABB-A17076-20UL,ABB-A17076-100UL,ABB-A17076-1000UL,ABB-A17076-500UL |
| Manufacturer: |
ABclonal |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Synthetic peptide. This information is considered to be commercially sensitive. |
| Alternative Names: |
NEDFLPH, NIFIE14, TMEM147 |
| Enables ribosome binding activity. Located in endoplasmic reticulum membrane. Part of protein-containing complex. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
25kDa |
| NCBI: |
10430 |
| UniProt: |
Q9BVK8 |
| Purity: |
Affinity purification |
| Sequence: |
MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIM |
| Target: |
TMEM147 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: |
Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag |
|
Western blot analysis of lysates from MCF7 cells, using TMEM147 Rabbit pAb (A17076) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |