TMEM147 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17076
Article Name: TMEM147 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17076
Supplier Catalog Number: A17076
Alternative Catalog Number: ABB-A17076-20UL,ABB-A17076-100UL,ABB-A17076-1000UL,ABB-A17076-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: NEDFLPH, NIFIE14, TMEM147
Enables ribosome binding activity. Located in endoplasmic reticulum membrane. Part of protein-containing complex.
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 10430
UniProt: Q9BVK8
Purity: Affinity purification
Sequence: MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIM
Target: TMEM147
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from MCF7 cells, using TMEM147 Rabbit pAb (A17076) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.