ADAMTS7 Rabbit pAb

Catalog Number: ABB-A17093
Article Name: ADAMTS7 Rabbit pAb
Biozol Catalog Number: ABB-A17093
Supplier Catalog Number: A17093
Alternative Catalog Number: ABB-A17093-20UL,ABB-A17093-100UL,ABB-A17093-500UL,ABB-A17093-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: ADAM-TS7, ADAMTS-7, ADAM-TS 7, ADAMTS7
The protein encoded by this gene is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and may regulate vascular smooth muscle cell (VSMC) migration. Mutations in this gene may be associated with susceptibility to coronary artery disease.
Clonality: Polyclonal
Molecular Weight: 184kDa
NCBI: 11173
UniProt: Q9UKP4
Purity: Affinity purification
Sequence: QTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR
Target: ADAMTS7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Ubiquitin.
Western blot analysis of lysates from SH-SY5Y cells, using ADAMTS7 Rabbit pAb (A17093) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5min.