CNNM4 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17130
Article Name: CNNM4 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17130
Supplier Catalog Number: A17130
Alternative Catalog Number: ABB-A17130-100UL,ABB-A17130-20UL,ABB-A17130-1000UL,ABB-A17130-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: ACDP4, CNNM4
This gene encodes a member of the ancient conserved domain containing protein family. Members of this protein family contain a cyclin box motif and have structural similarity to the cyclins. The encoded protein may play a role in metal ion transport. Mutations in this gene are associated with Jalili syndrome which consists of cone-rod dystrophy and amelogenesis imperfecta.
Clonality: Polyclonal
Molecular Weight: 87kDa
NCBI: 26504
UniProt: Q6P4Q7
Purity: Affinity purification
Sequence: VRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKASHENAI
Target: CNNM4
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using CNNM4 Rabbit pAb (A17130) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.