MAGEH1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17143
Article Name: MAGEH1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17143
Supplier Catalog Number: A17143
Alternative Catalog Number: ABB-A17143-20UL,ABB-A17143-100UL,ABB-A17143-500UL,ABB-A17143-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: APR1, APR-1, MAGEH, MAGEH1
This gene belongs to the non-CT (non cancer/testis) subgroup of the melanoma-associated antigen (MAGE) superfamily. The encoded protein is likely associated with apoptosis, cell cycle arrest, growth inhibition or cell differentiation. The protein may be involved in the atRA (all-trans retinoic acid) signaling through the STAT1-alpha (signal transducer and activator of transcription 1-alpha) pathway.
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 28986
UniProt: Q9H213
Purity: Affinity purification
Sequence: RRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVPRSNFQGTKKS
Target: MAGEH1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of lysates from mouse heart, using MAGEH1 Rabbit pAb (A17143) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.